Synthesized for Precision. Verified for Purity. HPLC Tested.
Every batch is analyzed by HPLC and the result is published on its Certificate of Analysis, so you can check what is in the vial against what is on the label.
HPLC Purity on
Every COA
Batch
Testing Data
HPLC tested, COA per batch.
Every batch is HPLC tested and its Certificate of Analysis is available to review before you order.
A rotating selection of the most-requested compounds in the catalog. Analytical documentation for a specific lot is available on request.
Nasal Sprays
CJC/Ipamorelin Spray is a spray-dispensed pairing of two unrelated peptides. The first, CJC-1295 No DAC (Mod GRF 1-29), is a tetrasubstituted analog of the first 29 residues of growth hormone-releasing hormone, with D-alanine at position 2, the formula C152H252N44O42, an average mass near 3367.9 g/mol and CAS 863288-34-0. The second, Ipamorelin, is a five-residue synthetic chain, Aib-His-D-2-Nal-D-Phe-Lys-NH2, with the formula C38H49N9O5, an average mass near 711.85 g/mol and CAS 170851-70-4. Each bottle is labeled 5/5 mg, meaning 5 mg of each peptide, and contains 45 sprays per bottle, sold for laboratory research use only.
Growth Hormone Secretagogue
CJC/Ipamorelin is a two-peptide research blend of CJC-1295 No DAC and Ipamorelin, 5 mg of each. CJC-1295 No DAC, also called Mod GRF 1-29, is a 29-residue growth hormone-releasing hormone analog, YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 with D-alanine at position 2 (C152H252N44O42, average mass about 3367.9 g/mol, CAS 863288-34-0 and 446036-97-1). Ipamorelin is the pentapeptide Aib-His-D-2-Nal-D-Phe-Lys-NH2 (C38H49N9O5, about 711.85 g/mol, CAS 170851-70-4), studied at the ghrelin receptor rather than the GHRH receptor. The vial is labeled 5/5 mg and is supplied strictly for laboratory research use only.
Nasal Sprays
GLP-T Spray is a spray-dispensed bottle of GLP-T, a lipidated 39-residue peptide whose chain follows native GIP, with aminoisobutyric acid at positions 2 and 13 and an amidated C-terminus. A C20 diacid is joined to lysine 20 through a linker. Reference values: formula C225H348N48O68, average mass about 4813.5 g/mol, CAS 2023788-19-2, research code LY3298176. It is one molecule engaging both GIP and GLP-1 receptors in assays, so it should not be mistaken for plain GIP. Each bottle holds 45 sprays, in 10, 20, 30 and 60 mg sizes, for laboratory research use only.
Nasal Sprays
Thymosin Alpha-1 Spray is a spray-dispensed form of thymosin alpha-1, a linear 28-amino-acid peptide with an acetylated N-terminal serine and the sequence Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH. Reference values for the peptide are formula C129H215N33O55, average mass 3108.3 g/mol and CAS 62304-98-7. The chain is the opening 28-residue stretch of prothymosin alpha, and it is a different molecule from thymosin beta-4 (43 residues) and from TB-500, a seven-residue piece of beta-4. One 10 mg size is offered, with 45 sprays per bottle, strictly for laboratory research use only.
Nasal Sprays
Melanotan II Spray is a spray-dispensed research bottle of Melanotan II, a seven-residue synthetic analogue of alpha-MSH written Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2. The ring is a lactam, an amide bond between the Asp and Lys side chains, and the chain ends in an amide. For the free peptide the formula is C50H69N15O9, the average mass is about 1024.2 g/mol and the CAS number is 121062-08-6. Melanotan 1 is a longer linear peptide and PT-141 differs by a free-acid terminus, so sequence and mass are the dependable identifiers. Each 10 mg bottle holds 45 sprays and is for laboratory research use only.
Nasal Sprays
Kisspeptin Spray is a spray-dispensed bottle of kisspeptin-10, the shortest natural kisspeptin: a linear decapeptide, Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe, with an amidated C-terminus. Reference values for the free peptide are formula C63H83N17O14, average mass 1302.45 g/mol and CAS 374675-21-5. Every natural kisspeptin ends in this same ten-residue core, so a label reading only "kisspeptin" leaves the chain length open, while a mass near 1302 rules out the 54-residue form at about 5857. Sold as a 10 mg bottle with 45 sprays per bottle, for laboratory research use only.
Healing & Recovery
LL-37 is a cationic peptide of 37 residues, [LL-37, 37 aa], named for its two opening leucines and its length. It is the C-terminal stretch of hCAP-18, the 170-residue human precursor (positions 134 to 170), and its chain holds no cysteine, so there are no disulfide bonds. Reference values are formula C205H340N60O53, average mass about 4493.3 g/mol and CAS 154947-66-7. The precursor protein and the short fragments KR-12 and FK-13 are different molecules. Veracue supplies LL-37 as a 1 mg vial, strictly for laboratory research use only.
Healing & Recovery
BPC/TB-500 is a two-peptide research material that places BPC-157 and TB-500 in one vial. BPC-157 is the 15-residue chain GEPPPGKPADDAGLV (C62H98N16O22, average mass about 1419.56 g/mol, CAS 137525-51-0). TB-500 is the N-acetylated 7-residue thymosin beta-4 fragment Ac-LKKTETQ (C38H68N10O14, about 889 g/mol, CAS 885340-08-9). The peptides are not chemically joined, so each keeps its own identifiers and the vial as a whole has no single formula or CAS number. Veracue supplies it in 5/5 mg and 10/10 mg vials, strictly for laboratory research use only.
Chromatography separates a sample into its components, and the resulting purity figure is reported on the Certificate of Analysis for each batch.
Each vial is labeled with a lot number so its analytical results can be matched to the exact batch you received.
Peptides are supplied as lyophilized powder, a stable format for storage until reconstitution.
Every batch is analyzed by HPLC and the result is published on its Certificate of Analysis, so you can review the data first.
Each batch is analyzed by reverse-phase HPLC, and the chromatogram and purity figure for that batch are reported on its Certificate of Analysis.
Mass spectrometry compares the measured molecular mass of a compound with its expected value, giving an identity check that sits alongside the HPLC data.
Peptides are supplied as a freeze-dried lyophilized powder in sealed vials, a format chosen to keep the compound stable until it is reconstituted for research.
Each batch has its own Certificate of Analysis, which you can look up by lot before ordering. Orders are packed for careful transit and shipped from the USA.
Each batch is HPLC tested and checked for identity, and the results are published on its Certificate of Analysis before you order.
Each batch is analyzed by reverse-phase HPLC, and the purity result for that batch is reported on its Certificate of Analysis.
Peptides are supplied freeze-dried as a lyophilized cake in a stoppered glass vial, a format used to keep the compound stable until reconstitution.
Mass spectrometry compares the measured molecular mass of the compound with its expected value, giving an identity check alongside the HPLC data.
Each vial is labeled with its lot number, and the Certificate of Analysis for that batch can be looked up in our COA archive before you order.
High-purity peptide sequences categorized by biological receptor pathway and analytical research application.
Documented Methods. Research Use Only.
Compounds in the Veracue catalog are made to a documented purity standard, and the analytical documentation for a specific lot can be requested. Not estimated, and not left to a marketing claim.
Our Scientific Approach
Every batch is analyzed by RP-HPLC, and the chromatogram and purity result for that batch are published on its Certificate of Analysis.
Peptides are supplied as a lyophilized powder in sealed vials, a format that keeps the compound stable until reconstitution.
Analytical testing supports the labeled quantity in each vial, and the batch COA is there so you can check the numbers yourself.
Every batch has a Certificate of Analysis with its chromatogram and results, available in our COA archive and on the product page.
Privacy & Security Notice
SECUREFor your protection, please redact (black out) sensitive information like your SSN. Documents are securely encrypted for review and permanently destroyed from our servers immediately upon approval.
Four checks stand between synthesis and your bench: sequence identity, mass precision, and cold-chain integrity, confirmed in that order before anything ships.
CAREFUL SCREENING OF EVERY RAW MATERIAL BATCH FOR MAXIMUM MOLECULAR PURITY.
HPLC ANALYSIS OF EVERY BATCH, WITH THE PURITY RESULT REPORTED ON ITS COA.
SEALED VIALS PACKED WITH INSULATION TO PROTECT THE PEPTIDE DURING TRANSIT.
TRACKED SHIPMENTS FROM THE USA, PACKED IN INSULATED CONTAINERS FOR RESEARCH USE.
Each Veracue Labs peptide is HPLC tested, and the Certificate of Analysis for its batch shows the purity result, so you can read the data before you buy.
View COA Archive
HPLC Tested ā¢ COA on Request, cross-referenced with independent batch chromatograms.
Guides and tools built for researchers evaluating compounds, planning studies, or preparing an order.
